PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_51EBF8930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 182aa    MW: 21243.4 Da    PI: 10.1376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_51EBF8930.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181763148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g WT+eEde l +av+ + g++Wk++a+ ++  Rt+ qc +rwqk+l
  Traes_1AL_51EBF8930.1 17 KGGWTPEEDETLRKAVTVFKGKNWKRVAEFFP-DRTEVQCLHRWQKVL 63
                           688*****************************.************986 PP

2Myb_DNA-binding57.82.5e-1869115148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+WT+eEd+ +++ vk++G+  W+ Iar +  gR +kqc++rw+++l
  Traes_1AL_51EBF8930.1  69 KGPWTQEEDDTIIQKVKEHGPTKWSVIARSLH-GRIGKQCRERWHNHL 115
                            79******************************.*************97 PP

3Myb_DNA-binding39.51.3e-12121154136
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRt 36 
                            + +WT eE++ lvda++++G++ W+ Ia+ ++ gR 
  Traes_1AL_51EBF8930.1 121 KEAWTFEEEQVLVDAHRMHGNK-WAEIAKLLP-GRI 154
                            579*******************.*********.996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2651263IPR017930Myb domain
SMARTSM007174.6E-141665IPR001005SANT/Myb domain
PfamPF002491.6E-151763IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-181882IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-241975IPR009057Homeodomain-like
CDDcd001679.86E-122063No hitNo description
PROSITE profilePS5129428.64264119IPR017930Myb domain
SuperFamilySSF466892.42E-2766157IPR009057Homeodomain-like
SMARTSM007178.1E-1668117IPR001005SANT/Myb domain
PfamPF002493.7E-1769115IPR001005SANT/Myb domain
CDDcd001671.41E-1271115No hitNo description
Gene3DG3DSA:1.10.10.604.9E-2676118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-15119155IPR009057Homeodomain-like
PROSITE profilePS5129410.372120169IPR017930Myb domain
SMARTSM007170.0026120167IPR001005SANT/Myb domain
PfamPF002491.4E-10121154IPR001005SANT/Myb domain
CDDcd001672.18E-6123153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
SYSTNIRRIS GPVRRAKGGW TPEEDETLRK AVTVFKGKNW KRVAEFFPDR TEVQCLHRWQ  60
KVLDPELIKG PWTQEEDDTI IQKVKEHGPT KWSVIARSLH GRIGKQCRER WHNHLDPQIR  120
KEAWTFEEEQ VLVDAHRMHG NKWAEIAKLL PGRIDLLVNG LLEILSLGCS AQILWVRPFA  180
AR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-60161555144MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-60161555144MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3635120.0AK363512.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2016D03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568309.15e-91PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
RefseqXP_010231305.15e-91PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
SwissprotQ9S7G71e-70MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLW4ZP641e-132W4ZP64_WHEAT; Uncharacterized protein
STRINGOB05G26770.11e-86(Oryza brachyantha)
STRINGSi000842m1e-86(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-87myb domain protein 3r-5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]